PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0060s0042.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family SRS
Protein Properties Length: 305aa    MW: 32373.4 Da    PI: 8.2261
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0060s0042.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702215.61.2e-66852343153
               DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrel.kskkqsalsstkl 91 
                           g++sCqdCGnqakkdCah+RCRtCC+srgf+C+thvkstWv+a  rrerqq+l++++++   +++++ skr re    +++sal + + 
  Kaladp0060s0042.1.p  85 GGSISCQDCGNQAKKDCAHSRCRTCCRSRGFECQTHVKSTWVAAPVRRERQQKLSQQQQNPLLRSSSEGSKRLREAgGPSSSSALVHHR- 173
                          5789********************************************************99999999999999982333333444444. PP

               DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                           + +s+ +   +++P+evs++avfrcvrvs++d+ge+++aYqtavsigGhvfkG+LydqGl+
  Kaladp0060s0042.1.p 174 -NPSSTGMEVGRTFPAEVSAQAVFRCVRVSAIDEGEDQYAYQTAVSIGGHVFKGLLYDQGLD 234
                          .333344445566***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.6E-6287234IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016239.8E-2589128IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.3E-28186233IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MAGLGGGRDR SSSQHHQQAA GAGAPPESWF LYRNPDELSS YRGFELWQQQ QQHQPRNNPS  60
SFGLGIGPDE PQLPTGFAMT RSAGGGSISC QDCGNQAKKD CAHSRCRTCC RSRGFECQTH  120
VKSTWVAAPV RRERQQKLSQ QQQNPLLRSS SEGSKRLREA GGPSSSSALV HHRNPSSTGM  180
EVGRTFPAEV SAQAVFRCVR VSAIDEGEDQ YAYQTAVSIG GHVFKGLLYD QGLDPSSYTP  240
GDSSSVGGGG SSSGGGGGGI QQLNFMSGGA AEATAFIDPS SMYHQSSHSN PFLPSGTQFF  300
PPQR*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046785.13e-79Lateral root primordium protein-related, putative
SwissprotQ9SD405e-64SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLS8DYK76e-81S8DYK7_9LAMI; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.16e-59Lateral root primordium (LRP) protein-related